missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SHB Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£328.00 - £513.00
Specifications
| Antigen | SHB |
|---|---|
| Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18489691
|
Novus Biologicals
NBP2-30557-25ul |
25ul |
£328.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18194335
|
Novus Biologicals
NBP2-30557 |
0.1 mL |
£513.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Descripción
SHB Polyclonal specifically detects SHB in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Especificaciones
| SHB | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| bA3J10.2, RP11-3J10.8, SH2 domain-containing adapter protein B, SHB (Src homology 2 domain containing) adaptor protein B, SHB adaptor protein (a Src homology 2 protein), Src homology 2 domain containing adaptor protein B | |
| SHB | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| Q15464 | |
| 6461 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: TACGGKKLLNKCAASAAEESGAGKKDKVTIADDYSDPFDAKNDLKSKAGKGESAGYM | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto