missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SH3TC1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£222.00 - £513.00
Specifications
| Antigen | SH3TC1 |
|---|---|
| Applications | Western Blot, Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18258052
|
Novus Biologicals
NBP2-58624 |
100 μL |
£513.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18631509
|
Novus Biologicals
NBP2-58624-25ul |
25 μL |
£222.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
SH3TC1 Polyclonal specifically detects SH3TC1 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.Specifications
| SH3TC1 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| 54436 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:AITFMTQAVEASAIAGVRAIVDHLVALAWLHVLHGQSPVALDILQSVRDAVVASEDQEGVIANMVAVALKRTGRTRQAAESYYRALRVARDLGQQRN | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot, Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| FLJ20356, FLJ32999, FLJ36243, FLJ46394, SH3 domain and tetratricopeptide repeats 1, SH3 domain and tetratricopeptide repeats-containing protein 1 | |
| SH3TC1 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title