missing translation for 'onlineSavingsMsg'
Learn More

SH3RF2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

£222.00 - £513.00

Specifications

Antigen	SH3RF2
Applications	Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 2

Product Code	Brand	Quantity	Price	Quantity & Availability
Product Code	Brand	Quantity	Price	Quantity & Availability
18623226 View Documents missing translation for 'viewProductCertificates'	Novus Biologicals NBP2-38841-25ul	25 μL	£222.00 25µL View alternative products Save Up to »		Please sign in to purchase this item. Need a web account? Register with us today!

18173258 View Documents missing translation for 'viewProductCertificates'	Novus Biologicals NBP2-38841	0.1 mL	£513.00 0.10mL View alternative products Save Up to »		Please sign in to purchase this item. Need a web account? Register with us today!

Description

SH3RF2 Polyclonal specifically detects SH3RF2 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

Antigen	SH3RF2
Classification	Polyclonal
Host Species	Rabbit
Research Discipline	Zinc Finger
Formulation	PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias	EC 6.3.2, EC 6.3.2.-, Heart protein phosphatase 1-binding protein, HEPP1FLJ23654, MGC149788, MGC149789, putative E3 ubiquitin-protein ligase SH3RF2, RING finger protein 158, RNF158MGC90410, SH3 domain containing ring finger 2, SH3 domain-containing RING finger protein 2
Gene Symbols	SH3RF2
Isotype	IgG
Purification Method	Affinity Purified

Applications	Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate	Unconjugated
Regulatory Status	RUO
Target Species	Human
Gene Accession No.	Q8TEC5
Gene ID (Entrez)	153769
Immunogen	This antibody was developed against a recombinant protein corresponding to amino acids: QGSLRKGRSSMRKNGSLQRPLQSGIPTLVVGSLRRSPTMVLRPQQFQFYQPQGIPSSPSAVVVEMGSKPALTGEPALTCISRGSE
Primary or Secondary	Primary
Test Specificity	Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

SH3RF2 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents