SH3PX1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-58144-25ul

Product Code. 18695226

Description

SH3PX1 Polyclonal specifically detects SH3PX1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: SH3PX1
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 μg/mL
• Gene Alias: MST155, MSTP155, Protein SDP1, SDP1, SH3 and PX domain-containing protein 1, SH3PX1WISP, SH3PXD3ASH3 and PX domain-containing protein SH3PX1, sorting nexin 9, sorting nexin-9, WiskSH3 and PX domain-containing protein 3A
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 51429
• Target Species: Human
• Isotype: IgG

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: SNX9
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:RVMYDFAAEPGNNELTVNEGEIITITNPDVGGGWLEGRNIKGERGLVPTDYVEILPSDGKDQFSCGNSVA
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.

For Research Use Only