missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SH3GL3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-88264
This item is not returnable.
View return policy
Description
SH3GL3 Polyclonal specifically detects SH3GL3 in Human samples. It is validated for Western Blot.
Specifications
| SH3GL3 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 6457 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| CNSA3, EEN-B2, endophilin-A3, SH3D2C, SH3-domain GRB2-like 3 | |
| The immunogen is a synthetic peptide directed towards the middle region of Human SH3GL3. Peptide Sequence EAALDYHRQSTEILQELQSKLQMRISAASSVPRREYKPRPVKRSSSELNG. The peptide sequence for this immunogen was taken from within the described region. | |
| 100 μL | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction