missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SH3BGRL Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | SH3BGRL |
|---|---|
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Regulatory Status | RUO |
Description
SH3BGRL Polyclonal specifically detects SH3BGRL in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| SH3BGRL | |
| Unconjugated | |
| RUO | |
| MGC117402, SH3 domain binding glutamic acid-rich protein like, SH3 domain-binding glutamic acid-rich-like protein, SH3BGR, SH3-binding domain glutamic acid-rich protein like | |
| SH3BGRL | |
| IgG |
| Polyclonal | |
| Rabbit | |
| O75368 | |
| 6451 | |
| Synthetic peptides corresponding to SH3BGRL(SH3 domain binding glutamic acid-rich protein like) The peptide sequence was selected from the middle region of SH3BGRL. Peptide sequence PQIFNESQYRGDYDAFFEARENNAVYAFLGLTAPPGSKEAEVQAKQQA. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title