missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
SH2D2A Polyclonal antibody specifically detects SH2D2A in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
Specifications
| Antigen | SH2D2A |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50 |
| Formulation | PBS, pH 7.2, 40% glycerol |
| Gene Alias | F2771, SCAP, SH2 domain containing 2A, SH2 domain protein 2A, SH2 domain-containing adapter protein, T cell specific adapter protein TSAd, T cell-specific adapter protein, T lymphocyte specific adaptor protein, TSAd, TSADSH2 domain-containing protein 2A, VEGF receptor-associated protein, VRAP |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PSNIYVEVEDEGLPATLGHPVLRKSWSRPVPGGQNTGGSQLHSENSVIGQGPPLPHQPPPAWRHTLPHNLSRQVLQDRGQAWLPLGPPQ |
| Purification Method | Affinity purified |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?