SH2D2A Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-17766-100UL

Product Code. 18364964

Description

SH2D2A Polyclonal antibody specifically detects SH2D2A in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: SH2D2A
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50
• Gene Alias: F2771, SCAP, SH2 domain containing 2A, SH2 domain protein 2A, SH2 domain-containing adapter protein, T cell specific adapter protein TSAd, T cell-specific adapter protein, T lymphocyte specific adaptor protein, TSAd, TSADSH2 domain-containing protein 2A, VEGF receptor-associated protein, VRAP
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: PSNIYVEVEDEGLPATLGHPVLRKSWSRPVPGGQNTGGSQLHSENSVIGQGPPLPHQPPPAWRHTLPHNLSRQVLQDRGQAWLPLGPPQ
• Quantity: 100 μg
• Research Discipline: Angiogenesis
• Gene ID (Entrez): 9047
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, 40% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified