missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
SH2B1 Polyclonal antibody specifically detects SH2B1 in Human samples. It is validated for Immunofluorescence
Specifications
Specifications
| Antigen | SH2B1 |
| Applications | Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml |
| Formulation | PBS, pH 7.2, 40% glycerol |
| Gene Alias | FLJ30542, KIAA1299, Pro-rich, PH and SH2 domain-containing signaling mediator, PSM, SH2 domain-containing protein 1B, SH2 domain-containing putative adapter SH2-B, SH2B adapter protein 1, SH2B adaptor protein 1, SH2-B signaling protein, SH2BDKFZp547G1110 |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: REFCESHARAAALDFARRFRLYLASHPQYAGPGAEAAFSRRFAELFLQHFEAEVARASGSLSPPILAPLSPGAEIS |
| Purification Method | Affinity purified |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?