SGTA Antibody (2E11), Novus Biologicals™

Mouse Monoclonal Antibody

Brand:  Novus Biologicals H00006449-M06

Product Code. 18328019

Description

SGTA Monoclonal antibody specifically detects SGTA in Human samples. It is validated for Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation, ELISA

Specifications

• Antigen: SGTA
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: In 1x PBS, pH 7.4
• Gene Alias: alphaSGT, Alpha-SGT, protein containing three tetratricopeptide repeats, SGT1, SGThSGT, small glutamine-rich tetratricopeptide repeat (TPR)-containing, small glutamine-rich tetratricopeptide repeat (TPR)-containing, alpha, small glutamine-rich tetratricopeptide repeat-containing protein alpha, UBP, Vpu-binding protein
• Immunogen: SGTA (NP_003012.1, 42 a.a. ~ 123 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. AFGVTVEDSDLALPQTLPEIFEAAATGKEMPQDLRSPARTPPSEEDSAEAERLKTEGNEQMKVENFEAAVHFYGKAIELNPA
• Quantity: 0.1 mg
• Research Discipline: Apoptosis, Cell Biology, Cell Cycle and Replication, Signal Transduction
• Gene ID (Entrez): 6449
• Content And Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Isotype: IgG2b κ

• Applications: Western Blot, ELISA, Immunocytochemistry, Immunoprecipitation, Sandwich ELISA
• Clone: 2E11
• Dilution: Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation, Sandwich ELISA
• Gene Accession No.: NP_003012
• Host Species: Mouse
• Purification Method: IgG purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified