missing translation for 'onlineSavingsMsg'
Learn More

SGK2 Antibody (7C7), Novus Biologicals™

Code produit 18396769 Tous les produits Bio Techne Produits
Change view
Click to view available options
Quantity:
0.1 mg
Conditionnement:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Code produit Quantity unitSize
18396769 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.
Code produit 18396769 Fournisseur Novus Biologicals Code fournisseur H00010110M08

Please to purchase this item. Need a web account? Register with us today!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Mouse Monoclonal Antibody

SGK2 Monoclonal antibody specifically detects SGK2 in Human samples. It is validated for Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence
TRUSTED_SUSTAINABILITY

Spécification

Antigen SGK2
Applications Western Blot, ELISA, Immunocytochemistry
Classification Monoclonal
Clone 7C7
Conjugate Unconjugated
Dilution Western Blot 1:500, ELISA, Immunocytochemistry/ Immunofluorescence
Formulation In 1x PBS, pH 7.4
Gene Accession No. AAH65511
Gene Alias dJ138B7.2, EC 2.7.11, EC 2.7.11.1, H-SGK2, serine/threonine-protein kinase Sgk2, serum/glucocorticoid regulated kinase 2, Serum/glucocorticoid-regulated kinase 2
Host Species Mouse
Immunogen SGK2 (AAH65511, 293 a.a. ~ 367 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SPINWDDLYHKRLTPPFNPNVTGPADLKHFDPEFTQEAVSKSIGCTPDTVASSSGASSAFLGFSYAPEDDDILDC
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline Protein Kinase
Primary or Secondary Primary
Gene ID (Entrez) 10110
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG1 κ
Afficher plus Afficher moins
Nom du produit
Sélectionnez un problème

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.