missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SFXN3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | SFXN3 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
SFXN3 Polyclonal specifically detects SFXN3 in Human samples. It is validated for Western Blot.Specifications
| SFXN3 | |
| Polyclonal | |
| Rabbit | |
| BA108L7.2, SFX3, sideroflexin 3, sideroflexin-3 | |
| SFXN3 | |
| IgG | |
| 36 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| 81855 | |
| Synthetic peptides corresponding to SFXN3(sideroflexin 3) The peptide sequence was selected from the middle region of SFXN3. Peptide sequence TPITVRQLGTAYVSATTGAVATALGLKSLTKHLPPLVGRFVPFAAVAAAN. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title