missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SFT2D3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£362.00
Specifications
| Antigen | SFT2D3 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
SFT2D3 Polyclonal specifically detects SFT2D3 in Human samples. It is validated for Western Blot.Specifications
| SFT2D3 | |
| Polyclonal | |
| Rabbit | |
| NP_116129 | |
| 84826 | |
| Synthetic peptide directed towards the N terminal of human SFT2D3. Peptide sequence EYLAQGKAGGPAAAEPLLAAEKAEEPGDRPAEEWLGRAGLRWTWARSPAE. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| MGC5391, SFT2 domain containing 3, SFT2 domain-containing protein 3, vesicle transport protein SFT2C | |
| SFT2D3 | |
| IgG | |
| 22 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title