missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SFRS3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£164.00 - £442.00
Specifications
| Antigen | SFRS3 |
|---|---|
| Dilution | Western Blot 1:500 - 1:2000, ELISA, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1:50 - 1:200, Immunohistochemistry-Paraffin 1:100 - 1:200 |
| Applications | ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin), Immunocytochemistry/Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
30227352
|
Novus Biologicals
NBP3-38224-20ul |
20 μL |
£164.00
20µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
30227237
|
Novus Biologicals
NBP3-38224-100ul |
100 μL |
£442.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
SFRS3 Polyclonal antibody specifically detects SFRS3 in Human,Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin),Immunocytochemistry/ImmunofluorescenceSpecifications
| SFRS3 | |
| ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin), Immunocytochemistry/Immunofluorescence | |
| Unconjugated | |
| Rabbit | |
| Human, Mouse, Rat | |
| Pre-mRNA-splicing factor SRP20, serine/arginine-rich splicing factor 3, SFRS3splicing factor, arginine/serine-rich, 20-kD, Splicing factor, arginine/serine-rich 3SRP20, SRp20 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human SFRS3 (NP_003008.1).,, Sequence:, MHRDSCPLDCKVYVGNLGNNGNKTELERAFGYYGPLRSVWVARNPPGFAFVEFEDPRDAADAVRELDGRTLCGCRVRVELSNGEKRSRNR | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
| Western Blot 1:500 - 1:2000, ELISA, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1:50 - 1:200, Immunohistochemistry-Paraffin 1:100 - 1:200 | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS (pH 7.3), 50% glycerol | |
| 6428 | |
| IgG | |
| Affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title