missing translation for 'onlineSavingsMsg'
Få mere at vide
Få mere at vide
Beskrivelse
SFRS15 Polyclonal specifically detects SFRS15 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Tekniske data
Tekniske data
| Antigen | SFRS15 |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 0.4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Formulation | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
| Gene Alias | CTD-binding SR-like protein RA4, FLJ23364, KIAA1172arginine/serine-rich 15, SFRS15, SR-like CTD-associated factor 4, SR-related and CTD-associated factor 4, SR-related CTD-associated factor 4 |
| Gene Symbols | SCAF4 |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:KVKPEELESFCEGGMLDSDTLNPDWKGIPKKPENEVAQNGGAETSHTEPVSPIPKPLPVPVPPIPVPAPITVPPPQVPPHQPGPPVVGALQP |
| Vis mere |
For Research Use Only
Produkttitel
Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.
Ser du en mulighed for forbedring?