SFPQ Antibody, Novus Biologicals™

Rabbit Monoclonal Antibody

Brand:  Novus Biologicals NBP3-33527-20ul

Product Code. 30232338

Description

SFPQ Monoclonal antibody specifically detects SFPQ in Human,Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Immunoprecipitation,Western Blot,Immunohistochemistry (Paraffin),Immunocytochemistry/Immunofluorescence

Specifications

• Antigen: SFPQ
• Classification: Monoclonal
• Dilution: Western Blot 1:50 - 1:200, ELISA Recommended starting concentration is 1 μg/mL, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1:50 - 1:200, Immunoprecipitation 0.5ug - 4ug antibody for 200ug - 400ug extracts of whole cells, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: 100 kDa DNA-pairing protein, DNA-binding p52/p100 complex, 100 kDa subunit, hPOMp100, polypyrimidine tract binding protein associated, polypyrimidine tract-binding protein-associated splicing factor, Polypyrimidine tract-binding protein-associated-splicing factor, PSFPOMP100, PTB-associated splicing factor, PTB-associated-splicing factor, splicing factor proline/glutamine rich (polypyrimidine tract binding proteinassociated), splicing factor proline/glutamine rich (polypyrimidine tract-bindingprotein-associated), splicing factor proline/glutamine-rich, splicing factor, proline- and glutamine-rich
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 600-707 of human SFPQ (P23246).,, Sequence:, MGYMDPRERDMRMGGGGAMNMGDPYGSGGQKFPPLGGGGGIGYEANPGVPPATMSGSMMGSDMRTERFGQGGAGPVGGQGPRGMGPGTPAGYGRGREEYEGPNKKPRF
• Quantity: 20 μL
• Research Discipline: DNA Repair, DNA replication Transcription Translation and Splicing
• Gene ID (Entrez): 6421
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: ELISA, Immunohistochemistry, Immunoprecipitation, Western Blot, Immunohistochemistry (Paraffin), Immunocytochemistry/Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Form: Purified