SFMBT2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Codice del prodotto	Marca	Quantity
18471651	Novus Biologicals NBP1-93582-25ul	25 μL
18044927	Novus Biologicals NBP1-93582	0.1 mL

Descrizione

SFMBT2 Polyclonal specifically detects SFMBT2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifica

• Antigen: SFMBT2
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500
• Classification: Polyclonal
• Host Species: Rabbit
• Target Species: Human
• Gene Alias: KIAA1617, Scm-like with four mbt domains 2, scm-like with four MBT domains protein 2
• Gene Symbols: SFMBT2
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Concentration: 0.2mg/mL
• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 57713
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:DFWCDVVIADLHPVGWCTQNNKVLMPPDAIKEKYTDWTEFLIRDLTGSRTAPANLLEGPLRGKGPIDLITVGSLIELQDSQN
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only