missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18387139

SF3B2 Antibody (5D2), Novus Biologicals™

Product Code. 18387139 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18387139 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18387139 Supplier Novus Biologicals Supplier No. H00010992M01

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Mouse Monoclonal Antibody

SF3B2 Monoclonal antibody specifically detects SF3B2 in Human, Mouse, Rat samples. It is validated for Western Blot, ELISA, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifications

Antigen SF3B2
Applications Western Blot, ELISA, Immunohistochemistry, Immunocytochemistry, Immunohistochemistry (Paraffin)
Classification Monoclonal
Clone 5D2
Conjugate Unconjugated
Dilution Western Blot 1:500, ELISA, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_006833
Gene Alias Cus1, pre-mRNA splicing factor SF3b 145 kDa subunit, Pre-mRNA-splicing factor SF3b 145 kDa subunit, SAP145SAP 145, SF3b1, SF3b145, SF3b150, spliceosome associated protein 145, Spliceosome-associated protein 145, splicing factor 3B subunit 2, splicing factor 3b, subunit 2, 145kD, splicing factor 3b, subunit 2, 145kDa
Host Species Mouse
Immunogen SF3B2 (NP_006833, 592 a.a. ~ 645 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. YEGKEFETRLKEKKPGDLSDELRISLGMPVGPNAHKVPPPWLIAMQRYGPPPSY
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 10992
Target Species Human, Mouse, Rat
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.