SF3A2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Marca:  Novus Biologicals NBP2-47281-25ul

Código de producto. 18626465

Descripción

SF3A2 Polyclonal specifically detects SF3A2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated.

Especificaciones

• Antigen: SF3A2
• Classification: Polyclonal
• Dilution: Western Blot 0.4 μg/mL, Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:1000 - 1:2500, Immunofluorescence
• Gene Alias: pre-mRNA splicing factor SF3A, subunit 2, PRP11, PRPF11, SAP 62, SAP62Prp11, SF3a66splicing factor 3a, subunit 2, 66kD, spliceosome associated protein 62, Spliceosome-associated protein 62, splicing factor 3A subunit 2, splicing factor 3a, subunit 2, 66kDa
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 8175
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: SF3A2
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: SSSESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECKLCLTLHNNEGSYLAHTQGKKHQTNLARRAAKEAKEAPAQPAPEKVKVE
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.

For Research Use Only