SET Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Product Code	Brand	Quantity
18196708	Novus Biologicals NBP2-38031	0.1 mL
18633336	Novus Biologicals NBP2-38031-25ul	25 μL

Description

SET Polyclonal specifically detects SET in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: SET
• Classification: Polyclonal
• Host Species: Rabbit
• Target Species: Human
• Gene Accession No.: Q01105
• Gene ID (Entrez): 6418
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: MAPKRQSPLPPQKKKPRPPPALGPEETSASAGLPKKGEKEQQEAIEHIDEVQNEID
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: 2PP2A, HLA-DR-associated protein II, I2PP2A, I-2PP2A, IGAAD, Inhibitor of granzyme A-activated DNase, inhibitor-2 of protein phosphatase-2A, IPP2A2, PHAPIITAF-I, Phosphatase 2A inhibitor I2PP2A, protein phosphatase type 2A inhibitor, protein SET, SET nuclear oncogene, SET translocation (myeloid leukemia-associated), TAF-IBETA, Template-activating factor I, Template-Activating Factor-I, chromatin remodelling factor
• Gene Symbols: SET
• Isotype: IgG
• Purification Method: Affinity Purified