missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SESN2 Antibody, Novus Biologicals™
Rabbit Monoclonal Antibody
Brand: Novus Biologicals NBP3-33447-100ul
This item is not returnable.
View return policy
Description
SESN2 Monoclonal antibody specifically detects SESN2 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot
Specifications
| SESN2 | |
| Monoclonal | |
| Western Blot 1:1000 - 1:5000, ELISA Recommended starting concentration is 1 μg/mL | |
| DKFZp761M0212, DKFZp761M02121, Hi95, HI95sestrin-2, SES2, SEST2hypoxia induced gene 95, sestrin 2 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 300-400 of human SESN2 (NP_113647.1).,, Sequence:, SADILEPSPHPDMLCFVEDPTFGYEDFTRRGAQAPPTFRAQDYTWEDHGYSLIQRLYPEGGQLLDEKFQAAYSLTYNTIAMHSGVDTSVLRRAIWNYIHCV | |
| 100 μL | |
| Cell Cycle and Replication | |
| 83667 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol, 0.05% BSA | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction