missing translation for 'onlineSavingsMsg'
Learn More

Serum Response Factor SRF Antibody (2C9), Novus Biologicals™

Product Code. 18343159 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18343159 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18343159 Supplier Novus Biologicals Supplier No. H00006722M04

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Mouse Monoclonal Antibody

Serum Response Factor SRF Monoclonal antibody specifically detects Serum Response Factor SRF in Human samples. It is validated for Western Blot, ELISA
TRUSTED_SUSTAINABILITY

Specifications

Antigen Serum Response Factor SRF
Applications Western Blot, ELISA
Classification Monoclonal
Clone 2C9
Conjugate Unconjugated
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_003122
Gene Alias MCM1, serum response factor, serum response factor (c-fos serum response element-binding transcriptionfactor)
Host Species Mouse
Immunogen SRF (NP_003122, 244 a.a. ~ 332 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TDLTYQVSESDSSGETKDTLKPAFTVTNLPGTTSTIQTAPSTSTTMQVSSGPSFPITNYLAPVSASVSPSAVSSANGTVLKSTGSGPV
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline Phospho Specific
Primary or Secondary Primary
Gene ID (Entrez) 6722
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.