SERTAD2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-79454

Product Code. 18258335

Description

SERTAD2 Polyclonal specifically detects SERTAD2 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: SERTAD2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: KIAA0127, MGC126688, Sei-2, SERTA domain containing 2, SERTA domain-containing protein 2, Transcriptional regulator interacting with the PHD-bromodomain 2, transcriptional regulator interacting with the PHS-bromodomain 2, TRIP-Br2MGC126690
• Host Species: Rabbit
• Molecular Weight of Antigen: 34 kDa
• Quantity: 100 μL
• Research Discipline: Cell Cycle and Replication
• Gene ID (Entrez): 9792
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_055570
• Gene Symbols: SERTAD2
• Immunogen: Synthetic peptide directed towards the N terminal of human SERTAD2. Peptide sequence: LQRQTIFNISLMKLYNHRPLTEPSLQKTVLINNMLRRIQEELKQEGSLRP
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Xenopus: 85%; Zebrafish: 77%.
• Target Species: Human, Mouse, Rat, Bovine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

For Research Use Only