missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SERTAD2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-79454
This item is not returnable.
View return policy
Description
SERTAD2 Polyclonal specifically detects SERTAD2 in Human samples. It is validated for Western Blot.
Specifications
| SERTAD2 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| KIAA0127, MGC126688, Sei-2, SERTA domain containing 2, SERTA domain-containing protein 2, Transcriptional regulator interacting with the PHD-bromodomain 2, transcriptional regulator interacting with the PHS-bromodomain 2, TRIP-Br2MGC126690 | |
| Rabbit | |
| 34 kDa | |
| 100 μL | |
| Cell Cycle and Replication | |
| 9792 | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| NP_055570 | |
| SERTAD2 | |
| Synthetic peptide directed towards the N terminal of human SERTAD2. Peptide sequence: LQRQTIFNISLMKLYNHRPLTEPSLQKTVLINNMLRRIQEELKQEGSLRP | |
| Affinity purified | |
| RUO | |
| Primary | |
| Expected identity based on immunogen sequence: Xenopus: 85%; Zebrafish: 77%. | |
| Human, Mouse, Rat, Bovine, Equine, Guinea Pig, Rabbit, Zebrafish | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction