missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Serpin D1/Heparin Cofactor II Antibody, Novus Biologicals™

Serpin D1/Heparin Cofactor II Antibody, Novus Biologicals™

Artikelnummer. 18426481 Alle ansehen Bio Techne Produkte
Change view
Click to view available options
Quantity:
0.1 mL
25 μL
Packungsgröße:
0.1mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Quantity unitSize
18426481 25 μL 25µL
18147964 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen
Artikelnummer. 18426481 Lieferant Novus Biologicals Lieferanten-Nr. NBP23376425ul

Please to purchase this item. Need a web account? Register with us today!

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Beschreibung

Rabbit Polyclonal Antibody

Serpin D1/Heparin Cofactor II Polyclonal specifically detects Serpin D1/Heparin Cofactor II in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Spezifikation

Antigen Serpin D1/Heparin Cofactor II
Applications Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin 1:200 - 1:500
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Accession No. P05546
Gene Alias HC2LS2, HCF2clade D (heparin cofactor), member 1, HC-II, Heparin cofactor II, HLS2HCII, leuserpin 2, Protease inhibitor leuserpin-2, Serpin D1, serpin peptidase inhibitor, clade D (heparin cofactor), member 1
Gene Symbols SERPIND1
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: EAQIADFSDPAFISKTNNHIMKLTKGLIKDALENIDPATQMMILNCIYFKGSWVNKFPVEMTHNHNFRLNE
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Cardiovascular Biology
Primary or Secondary Primary
Gene ID (Entrez) 3053
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Mehr anzeigen Weniger anzeigen

For Research Use Only

Name des Produkts
Wählen Sie ein Thema

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.