missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18347439

Novus Biologicals™ Serpin B8/Proteinase Inhibitor 8 Antibody, Novus Biologicals™

Product Code. 18347439 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Packungsgröße:
0.10mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Quantity unitSize
18347439 0.1 mg 0.10mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen
Artikelnummer. 18347439 Lieferant Novus Biologicals™ Lieferanten-Nr. H00005271D01P

Please to purchase this item. Need a web account? Register with us today!

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Beschreibung

Rabbit Polyclonal Antibody

Serpin B8/Proteinase Inhibitor 8 Polyclonal antibody specifically detects Serpin B8/Proteinase Inhibitor 8 in Human samples. It is validated for Western Blot
TRUSTED_SUSTAINABILITY

Spezifikation

Antigen Serpin B8/Proteinase Inhibitor 8
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Formulation PBS (pH 7.4)
Gene Accession No. NP_001027018.1
Gene Alias CAP-2, CAP2clade B (ovalbumin), member 8, Cytoplasmic antiproteinase 2, Peptidase inhibitor 8, PI-8, protease inhibitor 8 (ovalbumin type), serpin B8, serpin peptidase inhibitor, clade B (ovalbumin), member 8
Host Species Rabbit
Immunogen SERPINB8 (NP_001027018.1, 1 a.a. - 242 a.a.) full-length human protein. MDDLCEANGTFAISLFKILGEEDNSRNVFFSPMSISSALAMVFMGAKGSTAAQMSQALCLYKDGDIHRGFQSLLSEVNRTGTQYLLRTANRLFGEKTCDFLPDFKEYCQKFYQAELEELSFAEDTEECRKHINDWVAEKTEGKISEVLDAGTVDPLTKLVLVNAIYFKGKWNEQFDRKYTRGMLFKTNEEKKTVQMMFKEAKFKMGYADEVHTQVLELPYVEEELSMVILLPDDNTDLAVKE
Purification Method Protein A purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline Cardiovascular Biology
Primary or Secondary Primary
Gene ID (Entrez) 5271
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze/thaw cycles.
Form Purified
Isotype IgG
Mehr anzeigen Weniger anzeigen
Name des Produkts
Wählen Sie ein Thema

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.