missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Serpin A9/Centerin Antibody - Azide and BSA Free, Novus Biologicals™

Serpin A9/Centerin Antibody - Azide and BSA Free, Novus Biologicals™

Product Code. p-200062723 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.02 mL
0.1 mL
Unit Size:
0.02mL
0.10mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18666312 0.02 mL 0.02mL
18658741 0.1 mL 0.10mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18666312 Supplier Novus Biologicals Supplier No. NBP2939980.02ml

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

Serpin A9/Centerin Polyclonal antibody specifically detects Serpin A9/Centerin in Human samples. It is validated for Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen Serpin A9/Centerin
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:500-1:2000
Formulation PBS (pH 7.3), 50% glycerol
Gene Alias GCET1, SERPINA11, SERPINA11b
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 110-210 of human SERPINA9 (NP_783866.2). TQILQGLGFNLTHTPESAIHQGFQHLVHSLTVPSKDLTLKMGSALFVKKELQLQANFLGNVKRLYEAEVFSTDFSNPSIAQARINSHVKKKTQGKVVDIIQ
Purification Method Affinity purified
Quantity 0.02 mL
Regulatory Status RUO
Research Discipline Cancer, Cell Biology, Immunology
Primary or Secondary Primary
Gene ID (Entrez) 327657
Target Species Human
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.