missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Serpin A9/Centerin Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
£149.00 - £366.00
Specifications
| Antigen | Serpin A9/Centerin |
|---|---|
| Dilution | Western Blot 1:500-1:2000 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18666312
|
Novus Biologicals
NBP2-93998-0.02ml |
0.02 mL |
£149.00
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18658741
|
Novus Biologicals
NBP2-93998-0.1ml |
0.1 mL |
£366.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Serpin A9/Centerin Polyclonal antibody specifically detects Serpin A9/Centerin in Human samples. It is validated for Western BlotSpecifications
| Serpin A9/Centerin | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Cancer, Cell Biology, Immunology | |
| PBS (pH 7.3), 50% glycerol | |
| 327657 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500-1:2000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| GCET1, SERPINA11, SERPINA11b | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 110-210 of human SERPINA9 (NP_783866.2). TQILQGLGFNLTHTPESAIHQGFQHLVHSLTVPSKDLTLKMGSALFVKKELQLQANFLGNVKRLYEAEVFSTDFSNPSIAQARINSHVKKKTQGKVVDIIQ | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title