Serpin A5/Protein C Inhibitor Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-17021-25UL

Product Code. 18355864

Description

Serpin A5/Protein C Inhibitor Polyclonal antibody specifically detects Serpin A5/Protein C Inhibitor in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: Serpin A5/Protein C Inhibitor
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Alias: Acrosomal serine protease inhibitor, antitrypsin), member 5, member 5, PAI-3, PAI3PLANH3, PCIplasminogen activator inhibitor III, Plasminogen activator inhibitor 3, plasminogen activator inhibitor-3, PROCIplasma serine protease inhibitor, Protein C inhibitor, serine (or cysteine) proteinase inhibitor, clade A (alpha-1 antiproteinase, Serpin A5, serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), SERPNA5
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KWETSFNHKGTQEQDFYVTSETVVRVPMMSREDQYHYLLDRNLSCRVVGVPYQGNAT
• Quantity: 25 μg
• Research Discipline: Cancer
• Gene ID (Entrez): 5104
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, 40% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified