missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Serpin A1/alpha 1-Antitrypsin Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 8 publications
£229.00 - £459.00
Specifications
| Antigen | Serpin A1/alpha 1-Antitrypsin |
|---|---|
| Dilution | Western Blot 0.04-0.4 ug/ml, Simple Western reported by internal validation, Immunohistochemistry 1:2500 - 1:5000, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:2500-1:5000 |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18412872
|
Novus Biologicals
NBP1-90309-25ul |
25 μL |
£229.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18261297
|
Novus Biologicals
NBP1-90309 |
0.1 mL |
£459.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Serpin A1/alpha 1-Antitrypsin Polyclonal specifically detects Serpin A1/alpha 1-Antitrypsin in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| Serpin A1/alpha 1-Antitrypsin | |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| A1A, AATMGC23330, Alpha-1 protease inhibitor, Alpha-1-antiproteinase, alpha-1-antitrypsin, antitrypsin), member 1, member 1, PIMGC9222, serine (or cysteine) proteinase inhibitor, clade A (alpha-1 antiproteinase, serine (or cysteine) proteinase inhibitor, clade A, member 1, Serpin A1, serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin) | |
| SERPINA1 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot 0.04-0.4 ug/ml, Simple Western reported by internal validation, Immunohistochemistry 1:2500 - 1:5000, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:2500-1:5000 | |
| Polyclonal | |
| Rabbit | |
| Stem Cell Markers | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 5265 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:HDQDHPTFNKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYGAPHR | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title