missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Serine racemase Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£328.00 - £443.00
Specifications
| Antigen | Serine racemase |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18276523
|
Novus Biologicals
NBP2-58903 |
100 μL |
£443.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18605776
|
Novus Biologicals
NBP2-58903-25ul |
25 μL |
£328.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Serine racemase Polyclonal specifically detects Serine racemase in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| Serine racemase | |
| Polyclonal | |
| Rabbit | |
| Human | |
| 63826 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:QVPLVDALVVPVGGGGMLAGIAITVKALKPSVKVYAAEPSNADDCYQSKLKGKLMPNLYPPETIADGVKSSIGLNTWPIIRDLVDDIFTVTEDEIKCATQ | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| D-serine ammonia-lyase, D-serine dehydratase, EC 4.3.1.17, EC 4.3.1.18, EC 5.1.1.18, ILV1, ISO1, L-serine ammonia-lyase, L-serine dehydratase, serine racemase | |
| SRR | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title