missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Serine protease 23 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-79488
This item is not returnable.
View return policy
Description
Serine protease 23 Polyclonal specifically detects Serine protease 23 in Human samples. It is validated for Western Blot.
Specifications
| Serine protease 23 | |
| Polyclonal | |
| Synthetic peptide directed towards the C terminal of human PRSS23. Peptide sequence VSPPAKQLPGGRIHFSGYDNDRPGNLVYRFCDVKDETYDLLYQQCDAQPG. | |
| Affinity purified | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot | |
| Rabbit | |
| 41 kDa | |
| Rat, Canine | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction