missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SERCA1 ATPase Rabbit anti-Human, Mouse, Rat, Clone: 2T8S3, Novus Biologicals™
Description
SERCA1 ATPase Monoclonal antibody specifically detects SERCA1 ATPase in Human, Mouse, Rat samples. It is validated for Western Blot, Immunofluorescence
Specifications
Specifications
| Antigen | SERCA1 ATPase |
| Applications | Western Blot, Immunofluorescence |
| Classification | Monoclonal |
| Clone | 2T8S3 |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1:500 - 1:2000, Immunocytochemistry/Immunofluorescence 1:50 - 1:200 |
| Formulation | PBS, 0.05% BSA, 50% glycerol, pH7.3 |
| Gene Alias | ATP2A, ATPase, Ca++ transporting, cardiac muscle, fast twitch 1, Calcium pump 1, Calcium-transporting ATPase sarcoplasmic reticulum type, fast twitch skeletalmuscle isoform, EC 3.6.3, Endoplasmic reticulum class 1/2 Ca(2+) ATPase, sarcoplasmic/endoplasmic reticulum calcium ATPase 1, SERCA1EC 3.6.3.8, SR Ca(2+)-ATPase 1 |
| Host Species | Rabbit |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 900-1001 of human SERCA1 ATPase (O14983). ALSVLVTIEMCNALNSLSENQSLLRMPPWVNIWLLGSICLSMSLHFLILYVDPLPMIFKLRALDLTQWLMVLKISLPVIGLDEILKFVARNYLEDPEDERRK |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?