missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18355058

SERCA1 ATPase Antibody (4B8), Novus Biologicals™

Product Code. 18355058 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μg
Unit Size:
100µg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18355058 100 μg 100µg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18355058 Supplier Novus Biologicals Supplier No. H00000487M05100ug

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Mouse Monoclonal Antibody

SERCA1 ATPase Monoclonal antibody specifically detects SERCA1 ATPase in Human samples. It is validated for Western Blot, ELISA, Immunohistochemistry, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifications

Antigen SERCA1 ATPase
Applications Western Blot, ELISA, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Monoclonal
Clone 4B8
Conjugate Unconjugated
Dilution Western Blot 1:500
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_775293
Gene Alias ATP2A, ATPase, Ca++ transporting, cardiac muscle, fast twitch 1, Calcium pump 1, Calcium-transporting ATPase sarcoplasmic reticulum type, fast twitch skeletalmuscle isoform, EC 3.6.3, Endoplasmic reticulum class 1/2 Ca(2+) ATPase, sarcoplasmic/endoplasmic reticulum calcium ATPase 1, SERCA1EC 3.6.3.8, SR Ca(2+)-ATPase 1
Host Species Mouse
Immunogen ATP2A1 (NP_775293, 522 a.a. ~ 612 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. IDRCNYVRVGTTRVPLTGPVKEKIMAVIKEWGTGRDTLRCLALATRDTPPKREEMVLDDSARFLEYETDLTFVGVVGMLDPPRKEVTGSIQ
Purification Method IgG purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Cancer, Cardiovascular Biology, Endocrinology, Neurodegeneration, Neuroscience, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 487
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG3 κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.