missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Septin-9 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£222.00 - £513.00
Specifications
| Antigen | Septin-9 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18225882
|
Novus Biologicals
NBP2-55358 |
100 μL |
£513.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18608918
|
Novus Biologicals
NBP2-55358-25ul |
25 μL |
£222.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Septin-9 Polyclonal specifically detects Septin-9 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| Septin-9 | |
| Polyclonal | |
| Rabbit | |
| Cell Cycle and Replication | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 10801 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PAPVSQLQSRLEPKPQPPVAEATPRSQEATEAAPSCVGDMADTPRDAGLKQAPASRNEKAPVDFGYVGIDS | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| AF17q25, FLJ75490, KIAA0991Ov/Br septin, MLL septin-like fusion protein, MLL septin-like fusion protein MSF-A, MSF1NAPB, MSFMLL septin-like fusion, Ovarian/Breast septin, PNUTL4, SeptD1, septin 9, Septin D1, septin-9, SINT1 | |
| 43352 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title