missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SEPHS1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£328.00 - £470.00
Specifications
| Antigen | SEPHS1 |
|---|---|
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Regulatory Status | RUO |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18453351
|
Novus Biologicals
NBP1-87008-25ul |
25 μL |
£328.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18279196
|
Novus Biologicals
NBP1-87008 |
0.1 mL |
£470.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
SEPHS1 Polyclonal specifically detects SEPHS1 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| SEPHS1 | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 22929 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:MSTRESFNPESYELDKSFRLTRFTELKGTGCKVP | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Polyclonal | |
| Rabbit | |
| Stem Cell Markers | |
| EC 2.7.9.3, MGC4980, SELD, Selenium donor protein 1, Selenophosphate synthase 1, selenophosphate synthetase 1, selenophosphate synthetase 1 +E9a, selenophosphate synthetase 1 delta E2, selenophosphate synthetase 1 delta E8, selenophosphate synthetase 1 major, SPS1selenophosphate synthetase 1 +E9, water dikinase 1 | |
| SEPHS1 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title