Semaphorin 6A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-83155

Product Code. 18256126

Description

Semaphorin 6A Polyclonal specifically detects Semaphorin 6A in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Semaphorin 6A
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50
• Gene Alias: KIAA1368HT018, SEMA, sema domain, transmembrane domain (TM), and cytoplasmic domain, (semaphorin) 6A, Sema VIA, SEMA6A1, SEMA6A-1, semaphorin 6A-1, Semaphorin VIA, semaphorin-6A, Semaphorin-6A-1, SEMAQ, VIA
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: SEMA6A
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:RKDVAVVQRKEKELTHSRRGSMSSVTKLSGLFGDTQSKDPKPEAILTPLMHNGKLATPGNTAKMLIKADQHHLDLTAL
• Quantity: 0.1 mL
• Research Discipline: Apoptosis
• Gene ID (Entrez): 57556
• Target Species: Human
• Isotype: IgG

For Research Use Only