SEC61B Antibody - Azide and BSA Free, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-93984-0.1ml

Product Code. 18624162

Description

SEC61B Polyclonal antibody specifically detects SEC61B in Human, Mouse, Rat samples. It is validated for Western Blot, Immunocytochemistry/ Immunofluorescence, Gene Knock-Out

Specifications

• Antigen: SEC61B
• Classification: Polyclonal
• Dilution: Western Blot 1:500 - 1:2000, Immunocytochemistry/ Immunofluorescence 1:50-1:200, Knockout Validated
• Gene Alias: protein translocation complex beta, protein transport protein SEC61 beta subunit, protein transport protein Sec61 subunit beta, Sec61 beta subunit, Sec61 complex, beta subunit, SEC61B
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-96 of human SEC61B (NP_006799.1). MPGPTPSGTNVGSSGRSPSKAVAARAAGSTVRQRKNASCGTRSAGRTTSAGTGGMWRFYTEDSPGLKVGPVPVLVMSLLFIASVFMLHIWGKYTRS
• Quantity: 0.1 mL
• Research Discipline: Membrane Trafficking and Chaperones
• Gene ID (Entrez): 10952
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot, Immunofluorescence, Gene Knock-Out
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.3), 50% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Form: Purified