SEC61A Antibody - Azide and BSA Free, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-94505-0.1ml

Product Code. 18699170

Description

SEC61A Polyclonal antibody specifically detects SEC61A in Human, Mouse, Rat samples. It is validated for Western Blot, Immunocytochemistry/ Immunofluorescence

Specifications

• Antigen: SEC61A
• Classification: Polyclonal
• Dilution: Western Blot 1:500-1:2000, Immunocytochemistry/ Immunofluorescence 1:100 - 1:500
• Gene Alias: HSEC61, protein transport protein SEC61 alpha subunit, protein transport protein Sec61 subunit alpha, protein transport protein Sec61 subunit alpha isoform 1, SEC61, Sec61 alpha 1 subunit (S. cerevisiae), Sec61 alpha-1, sec61 homolog, SEC61A
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 310-420 of human SEC61A1 (NP_037468.1). ARFSGNLLVSLLGTWSDTSSGGPARAYPVGGLCYYLSPPESFGSVLEDPVHAVVYIVFMLGSCAFFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRETSMVHELNRYIPTA
• Quantity: 0.1 mL
• Research Discipline: Membrane Trafficking and Chaperones
• Gene ID (Entrez): 29927
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.3), 50% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Form: Purified