missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SEC23B Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£328.00 - £513.00
Specifications
| Antigen | SEC23B |
|---|---|
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Regulatory Status | RUO |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18272631
|
Novus Biologicals
NBP2-56982 |
100 μL |
£513.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18678208
|
Novus Biologicals
NBP2-56982-25ul |
25 μL |
£328.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
SEC23B Polyclonal specifically detects SEC23B in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| SEC23B | |
| Unconjugated | |
| RUO | |
| CDAII, CDA-II, CDAN2, congenital dyserythropoietic anemia, type II, HEMPASSec23 (S. cerevisiae) homolog B, protein transport protein Sec23B, Sec23 homolog B (S. cerevisiae), SEC23-like protein B, SEC23-related protein B, transport protein SEC23B | |
| SEC23B | |
| IgG | |
| Affinity Purified |
| Polyclonal | |
| Rabbit | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 10483 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:IDIYACALDQTGLLEMKCCANLTGGYMVMGDSFNTSLFKQTFQRIFTKD | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title