missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SCP2/SYCP2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£328.00 - £513.00
Specifications
| Antigen | SCP2/SYCP2 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18232371
|
Novus Biologicals
NBP2-56608 |
100 μL |
£513.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18631117
|
Novus Biologicals
NBP2-56608-25ul |
25 μL |
£328.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
SCP2/SYCP2 Polyclonal specifically detects SCP2/SYCP2 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| SCP2/SYCP2 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| NLTP, non-specific lipid-transfer protein, NSL-TP, Propanoyl-CoA C-acyltransferase, SCP-2, SCP-CHI, SCPX, SCP-X, Sterol Carrier Protein 2, Sterol carrier protein X | |
| SYCP2 | |
| IgG | |
| Affinity Purified |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 10388 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GERRANLLPKKLCKIEDADHHIHKMSESVSSLSTNDFSIPWETWQNEFAGIEMTYETYERLNSEFKRRNNIRHKMLSYFTTQSWKTAQQHLRTMNHQSQDSRI | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title