SCN7A Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-17309-100UL

Product Code. 18353287

Description

SCN7A Polyclonal antibody specifically detects SCN7A in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: SCN7A
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: Sodium channel protein cardiac and skeletal muscle subunit alpha, Sodium channel protein type VII subunit alpha, sodium channel, voltage-gated, type VI, alpha, sodium channel, voltage-gated, type VII, alpha, sodium channel, voltage-gated, type VII, alpha polypeptide, voltage-dependent sodium channel alpha subunit, voltage-gated, type VI, alpha polypeptide
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LAMAYEEEKQRVGEISKKIEPKFQQTGKELQEGNETDEAKTIQIEMKKRSPISTDTSLDVLEDATLRHKEELEKSKKICPLYWY
• Quantity: 100 μg
• Research Discipline: Neuroscience
• Gene ID (Entrez): 6332
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, 40% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified