SCN11A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-82600

Product Code. 18248225

Description

SCN11A Polyclonal specifically detects SCN11A in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: SCN11A
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50
• Gene Alias: hNaN, NaN, Nav1.9, Peripheral nerve sodium channel 5, PN5, SCN12A, SNS2, SNS-2, sodium channel, voltage-gated, type XI, alpha polypeptide, sodium channel, voltage-gated, type XI, alpha subunit, sodium channel, voltage-gated, type XII, alpha, voltage-gated sodium channel Nav1.9, Voltage-gated sodium channel subunit alpha Nav1.9, voltage-gated, type XII, alpha polypeptide
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: SCN11A
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:EERNGNLEGEARKTKVQLALDRFRRAFCFVRHTLEHFCHKWCRKQNLPQQKEVAGGCAAQSKDIIPLVME
• Quantity: 0.1 mL
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 11280
• Target Species: Human
• Isotype: IgG

For Research Use Only