missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18320979

SCN11A Antibody (6E1), Novus Biologicals™

Product Code. 18320979 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18320979 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18320979 Supplier Novus Biologicals Supplier No. H00011280M04

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Mouse Monoclonal Antibody

SCN11A Monoclonal antibody specifically detects SCN11A in Human samples. It is validated for Western Blot, ELISA
TRUSTED_SUSTAINABILITY

Specifications

Antigen SCN11A
Applications Western Blot, ELISA
Classification Monoclonal
Clone 6E1
Conjugate Unconjugated
Dilution Western Blot 1:500, ELISA
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_054858
Gene Alias hNaN, NaN, Nav1.9, Peripheral nerve sodium channel 5, PN5, SCN12A, SNS2, SNS-2, sodium channel, voltage-gated, type XI, alpha polypeptide, sodium channel, voltage-gated, type XI, alpha subunit, sodium channel, voltage-gated, type XII, alpha, voltage-gated sodium channel Nav1.9, Voltage-gated sodium channel subunit alpha Nav1.9, voltage-gated, type XII, alpha polypeptide
Host Species Mouse
Immunogen SCN11A (NP_054858, 1726 a.a. ~ 1791 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TTTKRKEEERGAAIIQKAFRKYMMKVTKGDQGDQNDLENGPHSPLQTLCNGDLSSFGVAKGKVHCD
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 11280
Target Species Human
Content And Storage Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.