SCN11A Antibody (6E1), Novus Biologicals™

Mouse Monoclonal Antibody

Brand:  Novus Biologicals H00011280-M04

Product Code. 18320979

Description

SCN11A Monoclonal antibody specifically detects SCN11A in Human samples. It is validated for Western Blot, ELISA

Specifications

• Antigen: SCN11A
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: In 1x PBS, pH 7.4
• Gene Alias: hNaN, NaN, Nav1.9, Peripheral nerve sodium channel 5, PN5, SCN12A, SNS2, SNS-2, sodium channel, voltage-gated, type XI, alpha polypeptide, sodium channel, voltage-gated, type XI, alpha subunit, sodium channel, voltage-gated, type XII, alpha, voltage-gated sodium channel Nav1.9, Voltage-gated sodium channel subunit alpha Nav1.9, voltage-gated, type XII, alpha polypeptide
• Immunogen: SCN11A (NP_054858, 1726 a.a. ~ 1791 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TTTKRKEEERGAAIIQKAFRKYMMKVTKGDQGDQNDLENGPHSPLQTLCNGDLSSFGVAKGKVHCD
• Quantity: 0.1 mg
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 11280
• Content And Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Isotype: IgG2a κ

• Applications: Western Blot, ELISA
• Clone: 6E1
• Dilution: Western Blot 1:500, ELISA
• Gene Accession No.: NP_054858
• Host Species: Mouse
• Purification Method: IgG purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified