missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SCL/Tal1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£292.00 - £488.00
Specifications
| Antigen | SCL/Tal1 |
|---|---|
| Dilution | Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL |
| Applications | Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18666098
|
Novus Biologicals
NBP2-68973-25ul |
25 μL |
£292.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18619566
|
Novus Biologicals
NBP2-68973 |
100 μg |
£488.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
SCL/Tal1 Polyclonal antibody specifically detects SCL/Tal1 in Human samples. It is validated for Immunocytochemistry/ ImmunofluorescenceSpecifications
| SCL/Tal1 | |
| Immunofluorescence | |
| Unconjugated | |
| Rabbit | |
| Phospho Specific | |
| PBS (pH 7.2) and 40% Glycerol | |
| 6886 | |
| IgG | |
| Protein A purified |
| Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| BHLHA17, bHLHa17tal-1, Class A basic helix-loop-helix protein 17, SCLT-cell acute lymphocytic leukemia protein 1, Stem cell protein, TAL-1, T-cell acute lymphocytic leukemia 1, T-cell leukemia/lymphoma protein 5, TCL5tal-1 product | |
| This antibody was developed against a recombinant protein corresponding to amino acids: PDDLLQDVLSPNSSCGSSLDGAASPDSYTEEPAPKHTARSLHPAMLPAADG | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title