missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SCFD2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | SCFD2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
SCFD2 Polyclonal specifically detects SCFD2 in Mouse samples. It is validated for Western Blot.Specifications
| SCFD2 | |
| Polyclonal | |
| Rabbit | |
| NP_848787 | |
| 152579 | |
| Synthetic peptide directed towards the middle region of human Scfd2The immunogen for this antibody is Scfd2. Peptide sequence LVSGLSSLCEHLGVREECFAVGPLSRVIATDLANYAPAKNRKKTATGRAS. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| FLJ21060, FLJ39514, sec1 family domain containing 2, STXBP1L1sec1 family domain-containing protein 2, syntaxin binding protein 1-like 1, Syntaxin-binding protein 1-like 1 | |
| Scfd2 | |
| IgG | |
| 52 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title