missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SCAND2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | SCAND2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
SCAND2 Polyclonal specifically detects SCAND2 in Human samples. It is validated for Western Blot.Specifications
| SCAND2 | |
| Polyclonal | |
| Rabbit | |
| SCAN domain containing 2 pseudogene | |
| SCAND2 | |
| IgG | |
| 18 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| 54581 | |
| Synthetic peptide directed towards the middle region of human SCAND2The immunogen for this antibody is SCAND2. Peptide sequence IQQVEQLKQEVSRLARERDAYKVKCEKLANSGFREAGSTSDSPSSPEFFL. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title