missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SCAMP1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | SCAMP1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
SCAMP1 Polyclonal specifically detects SCAMP1 in Mouse samples. It is validated for Western Blot.Specifications
| SCAMP1 | |
| Polyclonal | |
| Rabbit | |
| NP_083429 | |
| 9522 | |
| The immunogen for this antibody is Scamp1. Peptide sequence GSVKMPNVPNTQPAIMKPTEEHPAYTQITKEHALAQAELLKRQEELERKA. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| secretory carrier membrane protein 1SCAMP37SCAMP, secretory carrier-associated membrane protein 1 | |
| SCAMP1 | |
| IgG | |
| 38 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title