SC65 Antibody - Azide and BSA Free, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-94640-0.02ml

Product Code. 18678260

Description

SC65 Polyclonal antibody specifically detects SC65 in Human, Rat samples. It is validated for Western Blot

Specifications

• Antigen: SC65
• Classification: Polyclonal
• Dilution: Western Blot 1:500-1:2000
• Gene Alias: leprecan-like 4, Leprecan-like protein 4, NO55, 55kDa, NOL55, Nucleolar autoantigen No55, SC65rat synaptonemal complex protein, synaptonemal complex protein SC65
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 338-437 of human P3H4 (NP_006446.1). FHRARWGLEEEDFQPREEAMLYHNQTAELRELLEFTHMYLQSDDEMELEETEPPLEPEDALSDAEFEGEGDYEEGMYADWWQEPDAKGDEAEAEPEPELA
• Quantity: 0.02 mL
• Research Discipline: Cell Cycle and Replication
• Gene ID (Entrez): 10609
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.3), 50% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human, Rat
• Form: Purified