missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SC5DL Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-49478-25ul
This item is not returnable.
View return policy
Description
SC5DL Polyclonal antibody specifically detects SC5DL in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| SC5DL | |
| Polyclonal | |
| Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| 3beta-hydroxysteroid-delta5-desaturase, C-5 sterol desaturase, Delta(7)-sterol 5-desaturase, EC 1.14.21.6, ERG3, fungal ERG3, delta-5-desaturase-like, Lathosterol 5-desaturase, lathosterol dehydrogenase, lathosterol oxidase, S5DES, SC5D, Sterol-C5-desaturase, sterol-C5-desaturase (ERG3 delta-5-desaturase homolog, fungal)-like, sterol-C5-desaturase (ERG3 delta-5-desaturase homolog, S. cerevisiae)-like, sterol-C5-desaturase (fungal ERG3, delta-5-desaturase)-like | |
| This antibody was developed against a recombinant protein corresponding to amino acids: DLVLRVADYYFFTPYVYPATWPEDDIFRQAI | |
| 25 μL | |
| Primary | |
| Human | |
| Purified |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2), 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| 6309 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction