missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SAYSD1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | C6orf64 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
SAYSD1 Polyclonal specifically detects SAYSD1 in Human samples. It is validated for Western Blot.Specifications
| C6orf64 | |
| Polyclonal | |
| Rabbit | |
| Q9NPB0 | |
| 55776 | |
| Synthetic peptides corresponding to C6ORF64 The peptide sequence was selected from the C terminal of C6ORF64. Peptide sequence MYVGTRGPEEKKEGEKSAYSVFNPGCEAIQGTLTAEQLERELQLRPLAGR. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| C6orf64, chromosome 6 open reading frame 64, DKFZp434H012, FLJ11101, hypothetical protein LOC55776, SAYSVFN motif domain containing 1 | |
| SAYSD1 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title