SAV1 Antibody (3B2), Novus Biologicals™

Mouse Monoclonal Antibody

Brand:  Novus Biologicals H00060485-M02

Product Code. 18561160

Description

SAV1 Monoclonal antibody specifically detects SAV1 in Human, Mouse, Yeast samples. It is validated for Western Blot, ELISA, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation, Immunohistochemistry (Paraffin)

Specifications

• Antigen: SAV1
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: In 1x PBS, pH 7.4
• Gene Alias: 45 kDa WW domain protein, hWW45, protein salvador homolog 1, salvador homolog 1 (Drosophila), SAV, WW domain-containing, WW45salvador, WWP4,1700040G09Rik
• Immunogen: SAV1 (NP_068590, 300 a.a. ∽ 383 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. HTAEIPDWLQVYARAPVKYDHILKWELFQLADLDTYQGMLKLLFMKELEQIVKMYEAYRQALLTELENRKQRQQWYAQQHGKNF
• Quantity: 0.1 mg
• Research Discipline: Cell Biology, Signal Transduction
• Gene ID (Entrez): 60485
• Content And Storage: Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
• Isotype: IgG2a κ

• Applications: Western Blot, ELISA, Immunohistochemistry, Immunofluorescence, Immunoprecipitation, Immunohistochemistry (Paraffin)
• Clone: 3B2
• Dilution: Western Blot 1:500, ELISA 1:100-1:2000, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence 1:10-1:2000, Immunoprecipitation 1:10-1:500, Immunohistochemistry-Paraffin
• Gene Accession No.: NP_068590
• Host Species: Mouse
• Purification Method: IgG purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Yeast
• Form: Purified