SAT1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-37947-25ul

Artikelnummer. 18624765

Beschreibung

SAT1 Polyclonal specifically detects SAT1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Spezifikation

• Antigen: SAT1
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50
• Gene Accession No.: P21673
• Gene Symbols: SAT1
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: RLIKELAKYEYMEEQVILTEKDLLEDGFGEHPFYHCLV
• Quantity: 25 μL
• Research Discipline: Cancer, Cell Biology, Hypoxia, Mitochondrial Markers
• Gene ID (Entrez): 6303
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: DC21, diamine acetyltransferase 1, diamine N-acetyltransferase 1, EC 2.3.1.57, KFSD, Polyamine N-acetyltransferase 1, Putrescine acetyltransferase, SAT, Spermidine/spermine N(1)-acetyltransferase 1, spermidine/spermine N1-acetyltransferase, spermidine/spermine N1-acetyltransferase 1, spermidine/spermine N1-acetyltransferase alpha, SSAT-1, SSATKFSDX
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles.